PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0154s00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family bHLH
Protein Properties Length: 244aa    MW: 28071.1 Da    PI: 8.0088
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0154s00030.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH40.45.4e-1364116155
                        CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                        ++ +hn+ Er RR+++N+  + Lr+llP a   + kK+s  +++ ++ +YI +Lq
  Vradi0154s00030.1  64 KKLSHNASERDRRKKVNNLVSSLRSLLPMA--DQTKKMSIPATVSRVLKYIPELQ 116
                        6789*************************6..48888***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088813.763115IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474596.41E-1564133IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.26E-1064120No hitNo description
PfamPF000102.7E-1064116IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.106.1E-1264130IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.6E-969121IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MVALFSPIFS PKAWLLEEEP FGYNNTHNLL YKDDASSEYS FPYQFYSPQT QIELQPSSDP  60
AMVKKLSHNA SERDRRKKVN NLVSSLRSLL PMADQTKKMS IPATVSRVLK YIPELQQQVK  120
ALTKRKEELL CRISRQLEGD AVNKESHRKI SHHNSSFVVS TSRLNECEAV VHISCHETHK  180
VPLSEILQCL ENDGLFLLDA SSSETFGGRF FYNLHFQVEK TNRLEPEILI EKLLPIYEKQ  240
RIF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014489741.10.0PREDICTED: transcription factor ORG2-like
SwissprotQ9M1K18e-54ORG2_ARATH; Transcription factor ORG2
TrEMBLA0A0L9U7C31e-168A0A0L9U7C3_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RX611e-168A0A0S3RX61_PHAAN; Uncharacterized protein
STRINGGLYMA03G28630.11e-132(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24023379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.16e-45bHLH family protein